PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_17348_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 886aa    MW: 98017.1 Da    PI: 7.1185
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_17348_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.46.2e-41149226178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqve+C+adls+ak+yhrrhkvC++hska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Neem_17348_f_1 149 VCQVEDCRADLSNAKDYHRRHKVCDMHSKATKALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTHP 226
                     6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-32146211IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.129147224IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.67E-38148229IPR004333Transcription factor, SBP-box
PfamPF031103.7E-29150223IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 886 aa     Download sequence    Send to blast
MEAKFGGKVK NLYGPVVSDL KAVGKRSLEW DLNDWKWDGD LFTASPLNSV PSDCRNRQLF  60
PVGPEIPANG GRSNSSSSCS EDNNVGNEKG KRELEKRRRV VVVEDEELNN DEVGSLNLNL  120
GGQVYPVVDG DVKSGKKTKI VGSAVSRAVC QVEDCRADLS NAKDYHRRHK VCDMHSKATK  180
ALVGNVMQRF CQQCSRFHVL QEFDEGKRSC RRRLAGHNKR RRKTHPDNVV SGGSLNDERG  240
SSYLLISLLR ILANMHSNNS DQTKDQDLLS HLFRNLAGVV GTNNVRNISG LLQGSQGLLN  300
AGTSNGNVEK VSDVVSTGPE PVRSSASASM IDHCIRFSDP LRSVGQSGSV PASDLIQKRI  360
AAHDARSGIV QGLLGCQSKE AFPSRDSLSA KANELEATFG RSKMSNIDLN NVYDDSQDHI  420
ENLERSINLG TGSLCSRLWV QPASNKSTPP QTSANSDSTS SQSPSSSSGD AQSRTDRIVF  480
KLFGKDPNDF PIVLRRQILD WLSHSPTDIE SYIRPGCIIL TIYLRLGKPT WEELCCDLGS  540
SLRKLLDSSD DSFWRMGWLY ARVQHSVAFV YNGLLLLPLI SSVKPIAVSV SARAKFMVKG  600
FNLSWSTTRL LCAIEGKYLV QEACYDLMDG ADEHDELQHL SFVCSMPNVY GRGFIEVEDH  660
GLSSSFFPFI VAEQEVCSEI CMLEGVIEAA EISDNFQKIS EKTEIKDQAL DFVHEMGWLL  720
HRSRVKFRLG HLDSNSGLFS FKRFRWLMEF SMERDWCAVV KKLLGILFEG TVDTGEHTSI  780
ELALLDMGLL HRAVRRNCRP MVELLLHFSP GKELGKLGPQ QKQLVDKAGS SFIFKPDVIG  840
PAGLTPLHVA ACRDDAEHVL DALTDDPGLV RFHLLIPVLL NSNPLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-301492231084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19599KRRRV
2218224KRRRKTH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006488746.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X1
RefseqXP_006488747.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X1
SwissprotQ9S7P50.0SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBLV4S1A60.0V4S1A6_9R
STRINGPOPTR_0008s09810.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30302764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.10.0squamosa promoter-binding protein-like 12